Protein Info for UW163_RS21020 in Ralstonia solanacearum UW163

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 21 to 485 (465 residues), 557 bits, see alignment E=1.7e-171 PF02321: OEP" amino acids 76 to 271 (196 residues), 81.9 bits, see alignment E=2.7e-27 amino acids 299 to 483 (185 residues), 92.1 bits, see alignment E=1.9e-30

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsl:RPSI07_mp1231)

Predicted SEED Role

"RND efflux system, outer membrane lipoprotein, NodT family" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>UW163_RS21020 RND transporter (Ralstonia solanacearum UW163)
MTRGTHALRISRLLPRMVALAACALVTACAVGPDYKRPSAEVPQQYKETAGEWKVGTPSD
AIARGTWWEIFGDPQLNALEEQVAAANQNILVAEAQYREAQALVQSARAQFFPTLTGSAS
ASRSRSVRTTVNADGSLSTGSPTIANAQSLTLDASWELDLWGRIRRTVESNRASAQASAG
DLASALLSAQATLAQDYFQLRVTDTQKAVLQRTVADYERFLQLTQNQYAVGVAQRSDVLT
AQTQLKQAQALLLDAEVTRAQLEHAIAVLIGKSPSEFSLAPTGAATAQALPPLPDIPLEI
PSTVLERRPDIAAAERRMAAANADIGVAKAAYFPTLTLGASAGLSANTLSRLATLPSRIW
SIGPTLAATLFDGGARSAAVDKAGAAYDAAVGTYRQTVLGAFQDVEDNLAALRWQAQEFD
VQNDAVQSAQEAARLDLNRYRAGTVSFLEVITAQATAYTAERTLLTLQGKRYSAAVLLVK
ALGGGWHGEVPAVGPTAARTASTSTPAQ