Protein Info for UW163_RS20835 in Ralstonia solanacearum UW163

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 79 (18 residues), see Phobius details amino acids 99 to 118 (20 residues), see Phobius details amino acids 130 to 151 (22 residues), see Phobius details PF20327: DUF6622" amino acids 1 to 152 (152 residues), 77.7 bits, see alignment E=5.1e-26

Best Hits

KEGG orthology group: None (inferred from 89% identity to rsl:RPSI07_mp1184)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (164 amino acids)

>UW163_RS20835 hypothetical protein (Ralstonia solanacearum UW163)
MLASILSHTSTWVFVVFAGLILLGLRQAQPRTVSRRRLILLPLAVAGYSLYGVATASGYS
PPALAAWLLAMAMAFLLTRSAPPTGVHVEAGDSVRVPGSWLPMAVIVGLFVSRYAYHVML
AIHPEVRPATGFMALFSFVFGLLGGLLLSRSILLAARTPRLAAA