Protein Info for UW163_RS20760 in Ralstonia solanacearum UW163

Annotation: RND transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 508 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 23 to 494 (472 residues), 396.7 bits, see alignment E=7.3e-123 PF02321: OEP" amino acids 89 to 281 (193 residues), 77.4 bits, see alignment E=6.2e-26 amino acids 306 to 485 (180 residues), 110.8 bits, see alignment E=3.6e-36

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsl:RPSI07_mp1155)

Predicted SEED Role

"Outer membrane component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (508 amino acids)

>UW163_RS20760 RND transporter (Ralstonia solanacearum UW163)
MNAFTQHPGRPARPGRRTPLALAAALFLAACSLAPTYEKPDVGTPGAFKEAAQPADAPLA
AGEQGQWKTAEPSMPADGAWWKRFNDATLDSLEAQAAEASPTLAAAAARVGQARAIVQSN
RAALFPELDAGFGPTRQRTSAASAGLPVGAPVQPQTYWRAQATVAYEADLFGRVRNSVSA
ADADAERVEALYRAARLSLQADVAQTYFSLRTLDAEEALLARTVVGREEALKLVQRRFNT
GDIGELDVARADAELATARSERIDVARRRAVLEHALATLLGKAPSGFTLPATPLQAADLR
VPPGLPSALLERRPDVAAAERAMAAANARIGVARAAFFPQLQLTGGFGFESHDLGDLLKW
SSRTWLLGPLVGTALSLPIFDGGVRSAGVKQARAAYEENVANYREAVLVAFREVEDNLSD
LRLLADQSKVQDDAVRASTRAAQLSRTRYNAGSVNYLDVIDAERNMLSAQRVAVQLSGGR
VNATVGLVKALGGGWGDLPPAQTTVTQR