Protein Info for UW163_RS20230 in Ralstonia solanacearum UW163

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 PF00583: Acetyltransf_1" amino acids 42 to 128 (87 residues), 38.5 bits, see alignment E=2.6e-13 PF13673: Acetyltransf_10" amino acids 43 to 140 (98 residues), 42.7 bits, see alignment E=1.1e-14 PF13508: Acetyltransf_7" amino acids 55 to 129 (75 residues), 41.6 bits, see alignment E=2.6e-14 PF18014: Acetyltransf_18" amino acids 167 to 276 (110 residues), 77.2 bits, see alignment E=1.9e-25

Best Hits

KEGG orthology group: None (inferred from 95% identity to rsl:RPSI07_mp1040)

Predicted SEED Role

"Histone acetyltransferase HPA2 and related acetyltransferases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>UW163_RS20230 N-acetyltransferase (Ralstonia solanacearum UW163)
MLPSPVPAPNAIADDGVVLRPMTADDLPGAHALSEEQRWPHRPADWAQMFAHAEGIVAER
DGQIVATAQRWRWGPRHATIGLVIVASACQGRRIGHRLMSALLEGLDDSTVLLHATAEGR
GLYERLGFTRIGELRQHQGIAQPTPLIALPKDWRLRPAGLDEAAALHRLDAEARGMPREA
LIDDLLASADACVVLDHDGEPRGFAMLRRFGRGHAIGPVVAPDAEGAKALIAHLAGVNAG
HFTRIDIDFDSGLPEWLESIGLMRVDAPTTMVRGAPLSTPPDAPALFAIVTQATG