Protein Info for UW163_RS20030 in Ralstonia solanacearum UW163

Annotation: multidrug MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 52 to 75 (24 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 159 to 178 (20 residues), see Phobius details amino acids 184 to 206 (23 residues), see Phobius details amino acids 229 to 254 (26 residues), see Phobius details amino acids 266 to 286 (21 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details amino acids 344 to 362 (19 residues), see Phobius details amino acids 374 to 393 (20 residues), see Phobius details amino acids 399 to 421 (23 residues), see Phobius details

Best Hits

Swiss-Prot: 98% identical to EPSE_RALSL: EPS I polysaccharide export inner membrane protein EpsE (epsE) from Ralstonia solanacearum

KEGG orthology group: None (inferred from 91% identity to rsl:RPSI07_mp1009)

Predicted SEED Role

"EPS I polysaccharide export inner membrane protein epsE"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (436 amino acids)

>UW163_RS20030 multidrug MFS transporter (Ralstonia solanacearum UW163)
MQKTAPRPLPARISFFSASVLGLGAAVASRGAVFVSNILLAHSLTVHDFGLFSYAYVTAL
NLGLFLATGVSQAAGHVLPLIENPERKRRQLCAFIVLLVALIAVAAAALYLSSASISVAA
FGSEQGGGALRMAAIVLIATAFTQALQSFQYAMHEHRSSATISIGAAVLLLTMLWAMGPI
RQPVLALTIFLAVNAGAAVSQLLVLARATPSQRGPWRTGREELRLAVKHALPSVLTTSMG
APVHWICLSMLAAMTDGAHQLALFSVAFQWYIAITFIPATLGNLALPFLARHAGATEATV
RQRFRSALLFGGGLSLALGCASFLLAGEIFAWFYPAEYGSAASSMRSLSVAAALCGVSVL
LQQRIAAAGKFWRNFAMAAVYSVIYVAASYIALRLGFGATSIGLAMSAAYCCLILFQTLT
LQADSGAAIRLGRSFS