Protein Info for UW163_RS20025 in Ralstonia solanacearum UW163

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 36 to 54 (19 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 168 to 190 (23 residues), see Phobius details amino acids 211 to 242 (32 residues), see Phobius details amino acids 262 to 282 (21 residues), see Phobius details amino acids 297 to 316 (20 residues), see Phobius details amino acids 328 to 345 (18 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 379 to 396 (18 residues), see Phobius details PF14897: EpsG" amino acids 87 to 396 (310 residues), 79.6 bits, see alignment E=1.2e-26

Best Hits

Swiss-Prot: 97% identical to EPSF_RALSL: EPS I polysaccharide export inner membrane protein EpsF (epsF) from Ralstonia solanacearum

KEGG orthology group: None (inferred from 88% identity to rsl:RPSI07_mp1008)

Predicted SEED Role

"EPS I polysaccharide export inner membrane protein epsF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>UW163_RS20025 EpsG family protein (Ralstonia solanacearum UW163)
MKYSAPIRLNALSAIVSHHGVLVVIGMLLAVPMAFPLFPIAATYCVAILAILLPLGRLQH
VLATASSIAFAWLLTLRNPSRGLVEAGLGDDALHYMNAFYEFQQNYCCSPLDVLKTGIRS
AGGGEPVFWYLSYGVAKLFDTPLMVWAILIFISLMLVWMAIYRSTERFAYVVFVAYLSTI
TLYALQGSAIRQAVAAGLVMVALDLLIRRRLVWAACVGLIAAGTHSSAAALLLVGATVML
FLSKDYGMLARKASWLGQLGRLLVLLLLAVAAVAFGSAEFVMSKIQARLSENQTGSAWEL
QLAVEAVLACLFAWLFRMKLPREEKMTYFLFVLLCASTSFFAPAVGARLFRYTYCFYIVY
LCVFFFAREGESLGQKKTLASLLFLASLGWAFYIVNARYQGLFVSGGVIDHFLAGPFF