Protein Info for UW163_RS18915 in Ralstonia solanacearum UW163

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 11 to 117 (107 residues), 92.6 bits, E=4.4e-30
• PF02770: Acyl-CoA_dh_M
  • amino acids 121 to 215 (95 residues), 104.4 bits, E=5.8e-34
• PF00441: Acyl-CoA_dh_1
  • amino acids 228 to 383 (156 residues), 153.6 bits, E=9e-49
• PF08028: Acyl-CoA_dh_2
  • amino acids 245 to 371 (127 residues), 76.5 bits, E=4.9e-25

Best Hits

KEGG orthology group: K06446, acyl-CoA dehydrogenase [EC: 1.3.99.-] (inferred from 96% identity to rsl:RPSI07_mp0590)

MetaCyc: 87% identical to medium-chain acyl-CoA dehydrogenase (Cupriavidus necator H16)
RXN-22997 [EC: 1.3.8.7]

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

• oleate β-oxidation (31/35 steps found)
• fatty acid salvage (6/6 steps found)
• adipate degradation (5/5 steps found)
• pyruvate fermentation to butanol II (engineered) (4/6 steps found)
• pyruvate fermentation to hexanol (engineered) (7/11 steps found)
• 2-methyl-branched fatty acid β-oxidation (9/14 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (18/27 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.8.7, 1.3.99.-, 1.3.99.2

Use Curated BLAST to search for 1.3.8.7 or 1.3.99.- or 1.3.99.2

Protein Sequence (385 amino acids)

>UW163_RS18915 acyl-CoA dehydrogenase (Ralstonia solanacearum UW163)
MALDDESFGLLQPAVQRFIRERLVPAENILEEDDEVPADIVADMKAMGLFGLSIPEAYGG
IGLSMAQECEVVYDLGHTSFAFRSVFGTNVGIGSQGILMDGTEAQKAAYLPRIASGELII
SFALTEPDAGSDAASLQTRATPDGDHYVINGTKRFITNAPRAGAFTLMARTGGEGAGGIS
AFIVPADTPGITLGKPDRKMGQRGTKTCDVMLDNVRVSAANLIGGVAGQGFKTAMKVLDR
GRLHLSALACGMAHRLITDAAAYAKGRRQFGQPIADFQLIQAMLADSQAELYAGLSMVRD
CARRYDAKPAGRQDHEVSMLASCAKLFCTEMVGRVADRAVQIHGGAGYIAEYKVERFYRD
VRLLRLYEGTTQIQQLIIAKHLLRD