Protein Info for UW163_RS18800 in Ralstonia solanacearum UW163

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 530 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 113 (26 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 177 to 196 (20 residues), see Phobius details amino acids 214 to 232 (19 residues), see Phobius details amino acids 240 to 259 (20 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 314 to 332 (19 residues), see Phobius details amino acids 344 to 364 (21 residues), see Phobius details amino acids 370 to 392 (23 residues), see Phobius details amino acids 404 to 427 (24 residues), see Phobius details amino acids 489 to 510 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 422 (396 residues), 178.5 bits, see alignment E=2.8e-56 PF06609: TRI12" amino acids 41 to 442 (402 residues), 25 bits, see alignment E=9.5e-10 PF00083: Sugar_tr" amino acids 57 to 198 (142 residues), 29.9 bits, see alignment E=4.3e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to rsl:RPSI07_mp0561)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (530 amino acids)

>UW163_RS18800 MFS transporter (Ralstonia solanacearum UW163)
MAVHSALPHSHTQVLPFRESLLAMLGICFVIVLVALDQTVVGTALPTVVAELKGFDLYAW
VATSYLLTSVVTVPIFGRLGDFYGRKPFVVASIVVFTLASVMCGMAGSMAFLVWSRALQG
VGGGMLVGTAYACIADLFPDARVRLRWQVLLSAAFGIANAIGPTLGGWMTQALGWRSVFY
VNVPFGVLGLWFAWHFLPHLRQNLHAGRIRPDWQGALLITVALGALQFFVEWLPRHGLSL
PMLGWLVLSAAAFVGLWWWEQRAEQPLLPFDMVRNPALATLFVLATLSGFSMFVLLFYAP
LLFQGGFGMSPQQAGLVITPLVVCITLGSIINGRIVTRIPRPNVMLYAGFALLVLALAGM
AISSRATPQLALLLLMLLAGLGLGFVLPNLTVFAQQSAGRAHLGIATALLQSLRMVGGMV
GTALVGTLVSERYAGGVGDALRADRATQWLHRLADPEMLIDHDAQTALLAQMRSAGHDGA
ALLEAARHALVSAIHLGLIVATVVAVVGLWRVRRVPPVTLHHVEPVQAAE