Protein Info for UW163_RS18680 in Ralstonia solanacearum UW163

Annotation: magnesium chelatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 634 TIGR02442: cobaltochelatase subunit" amino acids 5 to 617 (613 residues), 833.1 bits, see alignment E=8e-255 PF01078: Mg_chelatase" amino acids 112 to 182 (71 residues), 28.4 bits, see alignment E=2.7e-10 PF17863: AAA_lid_2" amino acids 262 to 330 (69 residues), 67.3 bits, see alignment E=2.1e-22 PF13519: VWA_2" amino acids 455 to 557 (103 residues), 58.1 bits, see alignment E=3.1e-19

Best Hits

KEGG orthology group: K03404, magnesium chelatase subunit D [EC: 6.6.1.1] (inferred from 94% identity to rsl:RPSI07_mp0509)

Predicted SEED Role

"ChlI component of cobalt chelatase involved in B12 biosynthesis / ChlD component of cobalt chelatase involved in B12 biosynthesis" in subsystem Coenzyme B12 biosynthesis

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.6.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (634 amino acids)

>UW163_RS18680 magnesium chelatase (Ralstonia solanacearum UW163)
MKHPYPFSAIVGQEQLKRALLLCAIDPTLGGVLIRGDKGTAKSTAARGLTDVLPPITRVA
GCAFNCAPDAPLAECEACRSGTAAHASAPVPFINLPLGATEDRVLGHLDIERALKDGRKA
FQPGLLAAAHRGLLYIDEVNLLPDHLVDVLLDVSAMGHNTVEREGLAMRHPARITLLGTM
NLEEGDLRPQLLDRFGMMVEVTAPRDAAVRTEVVRRRLAFEADPAGFIAGWQADTDALRA
RLATAQAMLSRVALPDSLFAFISTLCCEFEVASLRADIVMHKAARALAALDGRAEVAAED
VRDAAELVLPHRRRRKPFEQPGLDRERLDELMQQAAPPPPQSAGTEADATPPEDDAGDTA
PADDATEQVFAAGTAATVGRIEVAARQAHDTGGRRSLATGTRRGHAIGAVPNEAPSRLAV
DATLRHALLRNPTDFSVTRADLHERVHAGRQGNLILLVADASGSMAARRRMEQVKAGVLG
LLQDAYQRRDQVALICFRGEQAELVLPPTRQVELAERALTALPTGGRTPLAHALQLAAQT
LAQQTDLTPLLVVISDGRANIALDAGQDPWREALALAEHLAARGTPALVLDTEQDYVRLG
RARELAQALQADCLPLDHLTGEQLTLTIRQRLPR