Protein Info for UW163_RS18525 in Ralstonia solanacearum UW163

Annotation: phenylacetate-CoA oxygenase subunit PaaI

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 transmembrane" amino acids 120 to 145 (26 residues), see Phobius details PF05138: PaaA_PaaC" amino acids 3 to 270 (268 residues), 304.8 bits, see alignment E=2.3e-95 TIGR02158: phenylacetate-CoA oxygenase, PaaI subunit" amino acids 17 to 270 (254 residues), 266.8 bits, see alignment E=1e-83

Best Hits

KEGG orthology group: K02611, phenylacetic acid degradation protein (inferred from 94% identity to rsl:RPSI07_mp0487)

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaI subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (270 amino acids)

>UW163_RS18525 phenylacetate-CoA oxygenase subunit PaaI (Ralstonia solanacearum UW163)
MQPTSTNDAHLRYVLRLADSALILGQRNAEWTGHGPVLEEDIALSNLSLDLIGQARLLYT
HAGRLEGALTGTPRSEDDYAYWRDEPAFRNYTLLELPHAGPLCGTAASRRDYAVTIVRHF
LYAALMVPLWEALAASVDAGLAAIAAKSVKEMRYHLAHTRDWLVRFGDGTAQSHARAQAA
LDWLMPYTNEFFAPDAVEDAVADAGIGVPPARVRGAWDATVRDALDEATLTWPEAGPYVS
TGKHGIHSEHMGYLLAEMQGLARQFPGATW