Protein Info for UW163_RS18415 in Ralstonia solanacearum UW163

Annotation: dicarboxylate/amino acid:cation symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 41 to 62 (22 residues), see Phobius details amino acids 74 to 98 (25 residues), see Phobius details amino acids 150 to 168 (19 residues), see Phobius details amino acids 185 to 207 (23 residues), see Phobius details amino acids 226 to 247 (22 residues), see Phobius details amino acids 310 to 338 (29 residues), see Phobius details amino acids 351 to 375 (25 residues), see Phobius details PF00375: SDF" amino acids 9 to 402 (394 residues), 370 bits, see alignment E=7.4e-115

Best Hits

Swiss-Prot: 90% identical to DCTA3_RALSO: C4-dicarboxylate transport protein 3 (dctA3) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K11103, aerobic C4-dicarboxylate transport protein (inferred from 90% identity to rsl:RPSI07_mp0988)

MetaCyc: 56% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>UW163_RS18415 dicarboxylate/amino acid:cation symporter (Ralstonia solanacearum UW163)
MIRKTLGKLYVQVLIGVAAGIVLGMLAPALGSDLKPLGDVFIKLIKMVFAPIIFATVTLG
IARMENMKELGRVGVRALIYFEVLSTFALALGLIVVNLAQPGQGMNVDAAHLDTKAIAGY
THAAARPQTFVDFLMSLVPSSIIDALARNDILQILVFATLFGIALSRMGGRARPVVDFLD
AFTHGMFSIVGMIMRLAPIAAFGAMAFTVGKYGLGSIVSLGKLMATMYLTCILFVAIVLG
GVARVSGFSLWKFLKYIRDEIFTVLGTSSSESVVPQLMHKLEAAGVSKPVVGLVVPAGLT
FNPDGQCIYYTMAAIFVAQATNTPLSLTDQLVVLGVLLLTSKGSAGVTGSGFITLAATLA
SLGNIPVAGMVLLLGIDRFMSEARAITNTIGNAVGTLAIARWVGAVDQQRLQATLDGTGT
PEPQPDPRVRHAPIRPAEAAHTPLAH