Protein Info for UW163_RS18085 in Ralstonia solanacearum UW163

Annotation: NarK/NasA family nitrate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 87 to 106 (20 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 146 to 171 (26 residues), see Phobius details amino acids 179 to 196 (18 residues), see Phobius details amino acids 227 to 247 (21 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 325 to 348 (24 residues), see Phobius details amino acids 360 to 385 (26 residues), see Phobius details amino acids 391 to 411 (21 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 379 (350 residues), 136.1 bits, see alignment E=7.3e-44 amino acids 248 to 423 (176 residues), 40.3 bits, see alignment E=9.8e-15

Best Hits

KEGG orthology group: K02575, MFS transporter, NNP family, nitrate/nitrite transporter (inferred from 93% identity to rsl:RPSI07_mp1511)

Predicted SEED Role

"Nitrate/nitrite transporter" in subsystem Nitrate and nitrite ammonification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (434 amino acids)

>UW163_RS18085 NarK/NasA family nitrate transporter (Ralstonia solanacearum UW163)
MSNTTIPLVSTEARAVAPQAYPVLVSSTFSFTICFAIWTMFAILGIPLQKQLGLSETEFG
LIASMPVLTGSLARVPLGIWTDRYGGRIVFFLLMLATVLPIWLVSYATQLWQFILLGVFV
GLAGGAFSVGTPYVARWFPKSRQGFAMGVFGAGNAGAALNKFVAPVLIVAAGTWTMVPRV
YAIGMLVTALLFWLFSSTDPSHASGRSVGVREQLRVMKDPRVWRYSQYYSVVFGGYVGLS
LWMTRYYVAEYGFSIKTAAFLAACFSLPGGVLRAIGGWVSDRYGAHRTSWAVMWVCWVAF
FLLSYPQTQLTVLSTRGPLDLHIGLTPVLFTVLMCVVGTAMAIGKASVFKFIANDFTDNI
GAVSGVVGLAGGLAGFVLPILFGVLVDLTGIHSTCFMLLYGTVCVSLVLMHFSFRAERGA
AEPARPGGLAQSAN