Protein Info for UW163_RS17735 in Ralstonia solanacearum UW163

Annotation: 2,3-diaminopropionate biosynthesis protein SbnA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 96% identical to SBNA_RALSO: N-(2-amino-2-carboxyethyl)-L-glutamate synthase (sbnA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01738, cysteine synthase A [EC: 2.5.1.47] (inferred from 96% identity to rso:RSp0417)

MetaCyc: 56% identical to N-(2-amino-2-carboxyethyl)-L-glutamate synthase (Staphylococcus aureus aureus NCTC 8325)
RXN-18395 [EC: 2.5.1.140]

Predicted SEED Role

"Cysteine synthase (EC 2.5.1.47)" in subsystem Cysteine Biosynthesis or Methionine Biosynthesis (EC 2.5.1.47)

MetaCyc Pathways

superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
L-cysteine biosynthesis I (2/2 steps found)
seleno-amino acid biosynthesis (plants) (3/5 steps found)
staphyloferrin B biosynthesis (2/7 steps found)
dapdiamides biosynthesis (2/13 steps found)
zwittermicin A biosynthesis (2/13 steps found)
superpathway of seleno-compound metabolism (6/19 steps found)
sulfazecin biosynthesis (3/16 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.47

Use Curated BLAST to search for 2.5.1.140 or 2.5.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>UW163_RS17735 2,3-diaminopropionate biosynthesis protein SbnA (Ralstonia solanacearum UW163)
MIAKSIVDCIGGTPLVQLARLYDGRKAEVFAKLEMLNPAGSIKDRPARYIIERGLAEGSI
APGTHIIESSSGNLAIALAMVCRVKGLRFTAVVDPKISPTNLNILRCYGAGIERVTRKDS
QGGYLETRIERVRQMLAQEPGAVWVNQYGNPRNWESHFYGEGDEIARALDRPADLLVLGV
STSGTVLGIARRLRREWPGLKVVAVDAVGSVLFGAKPGPRELPGIGASRVPELLCRDDID
DVIHVDDYDAAMGCRRLLEREGIFAGGSSGAVVVAIERLLARATRPLRIVTLLPDRGERY
LDSVYDDAWLARIAASRAGSTVSAAAPSLHVPSLEEVL