Protein Info for UW163_RS17720 in Ralstonia solanacearum UW163

Annotation: TonB-dependent siderophore receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 745 signal peptide" amino acids 1 to 50 (50 residues), see Phobius details PF07715: Plug" amino acids 102 to 204 (103 residues), 77.5 bits, see alignment E=1.1e-25 TIGR01783: TonB-dependent siderophore receptor" amino acids 104 to 745 (642 residues), 404.2 bits, see alignment E=5.8e-125 PF00593: TonB_dep_Rec" amino acids 321 to 714 (394 residues), 134 bits, see alignment E=1.4e-42

Best Hits

KEGG orthology group: K02014, iron complex outermembrane recepter protein (inferred from 95% identity to rsl:RPSI07_mp0375)

Predicted SEED Role

"Ferrichrome-iron receptor" in subsystem Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (745 amino acids)

>UW163_RS17720 TonB-dependent siderophore receptor (Ralstonia solanacearum UW163)
MLSSLRRMRASAAPSPARPSGAPFRPLALTARMAFAGLLTSGLGLPAFAQSAAKTSADTA
EHAIQLPETVATGRTDGGPVRPYAGGQTARGARAGLLGNKDTMDTPFSVSTYTAKRMEDQ
QAATLADVLNKDASVRFTGQTGGVTDSFYIRGFPVGEGNLSEVAFDGVYGVAPNYHVFPE
YVERVEVIKGPAALLYGMSPNSGVGGVVNIVPKRALPQDLTRFTATYASDSQLGGHVDLS
RRFGEGRAFGIRFNGVARQGNTPLDHQRSRTDIGALSLDYQGDRLRASLDVITQHEAVDA
PTRPFLLASGVAMPSAAEGRRNVSQPWGWWKSDGQSALAHAEYDASDRVTVFTDAGGSQT
SIGRLSDQTPTILDAAGNTRSTPGYYKFQVNRLTADAGVRARFDTGTVRHALTLQASTYH
DRVATANNMGTAILSNLYAPVSAPEQFIAAPAAVPKTSSSQLSGVAVADTMGVLDDRLQL
TLGLRQQKVSSDNFSASTGAVTSSYDKSAVTPMAGIVIKPWRDVSLYANYIEGLSKGDIA
PTTASNAGQVFAPYKTKQYEAGVKVDRNGLLATLAVFQITKPSGQLTGTVYGVDGEQRNR
GVELNLSGEPVGGVRLLGGVTVLDAVLTKTNSAATVGNRPVGVPGLMANAGAEWDLPWMP
GLALNGNVTYTAKEYLNQANTQSVPSWTTVDVGARYTTRLQGKSTTFRATVLNVFDRKYW
SGVASFGTISLGAPRTVLLSASVDF