Protein Info for UW163_RS17670 in Ralstonia solanacearum UW163

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 transmembrane" amino acids 63 to 85 (23 residues), see Phobius details amino acids 100 to 121 (22 residues), see Phobius details amino acids 132 to 150 (19 residues), see Phobius details amino acids 183 to 202 (20 residues), see Phobius details amino acids 211 to 228 (18 residues), see Phobius details amino acids 234 to 251 (18 residues), see Phobius details PF14378: PAP2_3" amino acids 101 to 245 (145 residues), 44.5 bits, see alignment E=1.6e-15 PF01569: PAP2" amino acids 186 to 249 (64 residues), 30.6 bits, see alignment E=2.6e-11

Best Hits

KEGG orthology group: None (inferred from 78% identity to rso:RS00861)

Predicted SEED Role

"PROBABLE TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (257 amino acids)

>UW163_RS17670 hypothetical protein (Ralstonia solanacearum UW163)
MPACANTRPEEASIADIDTRGTTRMPETEPPARASATACRVLPIQGDAAALSQAHRLPLV
SRIACGTVLGGVWAAGYFGIAWHVAPVADLTTALDTAIPFVGWTVWAYLAGLPWIVAPLA
VVREPGLFRRAACAYAIAIGTGFLCFTTLQTEAPALRAQSVPDGLGCTTSWALRTLHRAD
APVNLLPSLHVTLAWLAAWALARQHRRWRHACYAVAAAVTASVCLVKQHTVLDTLAGLLL
AWLCIRVTIPGRRRAFA