Protein Info for UW163_RS17295 in Ralstonia solanacearum UW163

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details PF00672: HAMP" amino acids 77 to 129 (53 residues), 28.8 bits, see alignment 1.9e-10 PF00512: HisKA" amino acids 139 to 197 (59 residues), 34.9 bits, see alignment E=1.9e-12 PF02518: HATPase_c" amino acids 243 to 351 (109 residues), 84.9 bits, see alignment E=8.1e-28

Best Hits

KEGG orthology group: K02486, two-component system, unclassified family, sensor kinase [EC: 2.7.13.3] (inferred from 94% identity to rso:RS05453)

Predicted SEED Role

"Signal transduction histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>UW163_RS17295 sensor histidine kinase (Ralstonia solanacearum UW163)
MKLAGLSRQIALSMMAMAFGVTLLVVLTSYAFYYLAWTYWSRDFCQTSWLPTGPEWVWML
ATTLVGLAMAIVVAVNLAGRILVPLNSVADSLRRAARGDLGVRAIAGDRSLGEAALLADD
FNALADQLQRVTEEQVFWNAAIAHELRTPVTILRGRLQGLAEGVFTPDAPQFRSLLTQVE
GLARLIEDLRVVSLAESGHLDLQVRESDLSAEVKAVVAFFGDVLRAAGQHPVLDLEARRM
RCDPVRIRQALLALLENVHRHAVPGSIRVQTRIGHGRCHLRVEDDGPGIPADFVPHVFEA
FRRSDDARSSASGGSGLGLAVVAAIAHAHGGQASCSRAAGGGTLFELHWPEHCAPAPHPT