Protein Info for UW163_RS17245 in Ralstonia solanacearum UW163

Annotation: 3-oxoacyl-ACP reductase FabG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 PF00106: adh_short" amino acids 17 to 207 (191 residues), 196.7 bits, see alignment E=5.7e-62 PF01370: Epimerase" amino acids 19 to 181 (163 residues), 21.2 bits, see alignment E=3.4e-08 PF08659: KR" amino acids 19 to 177 (159 residues), 51.1 bits, see alignment E=3.3e-17 PF13561: adh_short_C2" amino acids 25 to 254 (230 residues), 222.8 bits, see alignment E=9.7e-70

Best Hits

Swiss-Prot: 38% identical to Y2146_BRADU: Probable short-chain type dehydrogenase/reductase blr2146 (blr2146) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: K00059, 3-oxoacyl-[acyl-carrier protein] reductase [EC: 1.1.1.100] (inferred from 90% identity to rsl:RPSI07_mp0286)

MetaCyc: 42% identical to antimycin intermediate C8-ketoreductase monomer (Streptomyces sp. S4(2010))
1.1.1.-

Predicted SEED Role

"Enoyl-[acyl-carrier-protein] reductase [NADPH] (EC 1.3.1.10)" in subsystem Fatty Acid Biosynthesis FASII (EC 1.3.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.3.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (255 amino acids)

>UW163_RS17245 3-oxoacyl-ACP reductase FabG (Ralstonia solanacearum UW163)
MSHTPSTVSHPRLAGRAAIVTGGSRGIGAAIACRLAADGARVAVVYRSQRGEADAVVRAI
RDAGAEALAIQADVSDAASVQAMADTARRAFGGIDILVNNAGILAGQPVGSIDQASFDLQ
FRTNAFSAILVSQAVLPHMPARGGRIVNVSSSLVFRPRAGLAVYAASKAAVSALTQAFAL
ELGPRNITVNAVAPAMTRTDMTAPLPDALKARMREATPLGRLAEPDDIADAVAFLASDDS
RWITGRTLLTDGGFV