Protein Info for UW163_RS17180 in Ralstonia solanacearum UW163

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 471 transmembrane" amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 126 (25 residues), see Phobius details amino acids 138 to 157 (20 residues), see Phobius details amino acids 164 to 190 (27 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 236 to 255 (20 residues), see Phobius details amino acids 291 to 315 (25 residues), see Phobius details amino acids 327 to 345 (19 residues), see Phobius details amino acids 356 to 375 (20 residues), see Phobius details amino acids 381 to 399 (19 residues), see Phobius details amino acids 418 to 440 (23 residues), see Phobius details amino acids 446 to 466 (21 residues), see Phobius details PF00083: Sugar_tr" amino acids 70 to 269 (200 residues), 67.4 bits, see alignment E=1.2e-22 PF07690: MFS_1" amino acids 107 to 431 (325 residues), 82.1 bits, see alignment E=3.8e-27

Best Hits

KEGG orthology group: None (inferred from 92% identity to rsl:RPSI07_mp0977)

Predicted SEED Role

"PROBABLE TRANSPORTER TRANSMEMBRANE PROTEIN"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (471 amino acids)

>UW163_RS17180 MFS transporter (Ralstonia solanacearum UW163)
MTHAEVKSGTWPAASDASMVRQEGAQGGIVSATSAAFAGHGSMDRERSPVTALDPPPNGY
AAVRASLASLLGSTIEWYDFFLYGAASALVFNQVFFPKLGALSGTIAAFGTYGLGFVVRP
LGALAFGHFGDRLGRKTVLLASLLAMGLPTVLIGLLPSYDAIGYLAPLLLIVLRLVQGFA
VGGEWGAVILAVEHASPRFKGLLGGLSQTGVAAGLTLSSLAMAAVNSIGHDAMLGWAWRI
PFVGSGLLIAIGWLLRRKVDETPEFTSARQQGRCLTYPIGNVFKDHAGALLSVAGARVAE
ISFFYIVTAFTLWYATRQLGLPEAWCLNGVTLGAAAATFLMPLCGMLGDRWGARRIYIAG
IVTALLWILPFFMLVNTRSMVWVMFAETVSVVLSFSMAAQQASLFVQQFPVVARYTGASL
AVNIAGALGGLAPIVATTLLGKAQGGVISIAGYVVALAAISIASALRLKRV