Protein Info for UW163_RS17160 in Ralstonia solanacearum UW163

Annotation: two-component sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 438 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 112 to 128 (17 residues), see Phobius details amino acids 140 to 161 (22 residues), see Phobius details PF08521: 2CSK_N" amino acids 16 to 137 (122 residues), 33 bits, see alignment E=8.8e-12 PF00512: HisKA" amino acids 216 to 280 (65 residues), 49.8 bits, see alignment E=4.4e-17 PF02518: HATPase_c" amino acids 327 to 435 (109 residues), 85.6 bits, see alignment E=4.9e-28

Best Hits

KEGG orthology group: K02484, two-component system, OmpR family, sensor kinase [EC: 2.7.13.3] (inferred from 96% identity to rso:RS02109)

Predicted SEED Role

"Sensor protein basS/pmrB (EC 2.7.3.-)" in subsystem Lipid A modifications or Orphan regulatory proteins (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3, 2.7.3.-

Use Curated BLAST to search for 2.7.13.3 or 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (438 amino acids)

>UW163_RS17160 two-component sensor histidine kinase (Ralstonia solanacearum UW163)
MQSIRKTLLWWLAGGLLAGIVAATLLIYAQARQEANALFDYQMQQVAAALPSQWIDPPPP
ALAGIAHDDDVVIRIWDGTGRSLYLSHARPDLPAQAELGFSDVVTPEGTWRVYSVAFGPA
VVQIAQPYSARHEVAARMALRTVAPLLILLPLLAWLVWLAVGRGLSPLGTVARQVQARDA
AALSPLPTHGLPAEIRPLTTALNDLLARLGDALAHQRAFVADAAHALRTPLAALKLQLQV
ADRAQSDAERRAAHADLHRGVERMIRLVGQLLTLARQEPGAADTQRGPVALDAIAAEVVA
ELTPAALQKRIDLGIGVESQPASVSGNADALRVLLVNLVDNALCYCPEGARVDVSAGHTP
DGGVQLVVEDNGPGIPAAERERVLDRFYRSAQAPTGGSGLGLAIVREIAQAHDATLALEA
RDGGGLRVVLRFPFRAAA