Protein Info for UW163_RS16735 in Ralstonia solanacearum UW163

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 346 PF00356: LacI" amino acids 9 to 54 (46 residues), 69.2 bits, see alignment 4.1e-23 PF00532: Peripla_BP_1" amino acids 67 to 311 (245 residues), 89.5 bits, see alignment E=5.5e-29 PF13407: Peripla_BP_4" amino acids 68 to 314 (247 residues), 47.6 bits, see alignment E=3.3e-16 PF13377: Peripla_BP_3" amino acids 178 to 341 (164 residues), 129.6 bits, see alignment E=2.6e-41

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 97% identity to rsl:RPSI07_mp1743)

Predicted SEED Role

"FIG00975592: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (346 amino acids)

>UW163_RS16735 LacI family transcriptional regulator (Ralstonia solanacearum UW163)
MKRGAGAVTVDDVAEHAGVSIKTVSRVLNHEPNISEKTRQKVVEAMQRLDYRPNPAARRL
ASKRADIIALVYDNPSDNYIVNIQHGALEACQALDYSLLLSPCNYRDPHLAEQMIQSVRQ
RALAGLLLTPPVSDVPALIRALDEAGVDYVRLAPADREPKGLSVHTEDRAAARDMTLHLI
GLGHRRIGFVVCDPDHGAAYSRVFGYRDAMAQAGIEVDERLVEQGQHSFESGMACAERLL
SREPRPTAIFAGNDDMAAGVLRVAQARGIKVPEELSIAGYDDTPLSRQLWPSLTTVRQPI
QDMAYAAVEQLIAIHRPHLPGLRPHSEHESLQYELVIRDSTCPPPR