Protein Info for UW163_RS16390 in Ralstonia solanacearum UW163

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 39 to 59 (21 residues), see Phobius details amino acids 218 to 243 (26 residues), see Phobius details PF12729: 4HB_MCP_1" amino acids 36 to 211 (176 residues), 74 bits, see alignment E=2.9e-24 PF02203: TarH" amino acids 36 to 193 (158 residues), 25.6 bits, see alignment E=2.7e-09 PF00672: HAMP" amino acids 239 to 289 (51 residues), 36.4 bits, see alignment 1.3e-12 PF00512: HisKA" amino acids 321 to 384 (64 residues), 44.8 bits, see alignment E=2.7e-15 PF02518: HATPase_c" amino acids 435 to 543 (109 residues), 93.7 bits, see alignment E=2.6e-30

Best Hits

KEGG orthology group: None (inferred from 92% identity to rsl:RPSI07_mp0033)

Predicted SEED Role

"FIG00978077: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (546 amino acids)

>UW163_RS16390 histidine kinase (Ralstonia solanacearum UW163)
MTRQTHSPASSTETATKTVPARGMRGLGTPSILRPIRVRLSLVFVTFLLLVIGVGVFGID
QLASFHSVSAQISGRWLQSSRLLGDLNNYISDYRAAEGDSLIATTRADARAADQQIATLD
DMIAAAQARYDRIEHDAAEHELYRQFVTQWTTYRELAKRVRITVKSGEPAGAVQLYHGES
RRAYDSANDTLAVLTERNVAGAAAETEREAQAYRDARHWIIGAIVVAAGLVAVAVAYLVL
AVSRPIAALVERMHRIANNDHDAHVDIPGLERRDEIGAIAQAVARFRDNTIELGRSKDAL
VSQAVVLQDMLAKERRMAELQRNFVSMASHEFRTPLGVIDGHAQRLMRMREAPAPEVLEE
RCGRIRAAVQRMTHLMDHLLDSSQRLDSTTPAAVRCTHFPLAELLHEVCEMHRDSSPGAR
IEERLDDGAPQTFYGDARLLFQAFSNLVGNAIKYSPPHALVTVQVSGDAESICVSVADQG
LGIPERDIDRLFERYVRGGNVAGTVGAGVGLYLVKLVVELHRGTISVNSVQGRGSRFVVR
LPRLEA