Protein Info for UW163_RS15865 in Ralstonia solanacearum UW163

Annotation: peptidase M48

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 99 to 126 (28 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details amino acids 291 to 310 (20 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details PF16491: Peptidase_M48_N" amino acids 26 to 204 (179 residues), 203.2 bits, see alignment E=3.1e-64 PF01435: Peptidase_M48" amino acids 207 to 414 (208 residues), 114.5 bits, see alignment E=5.4e-37

Best Hits

KEGG orthology group: K06013, STE24 endopeptidase [EC: 3.4.24.84] (inferred from 98% identity to rsc:RCFBP_20527)

Predicted SEED Role

"macromolecule metabolism; macromolecule degradation; degradation of proteins, peptides, glycopeptides"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.24.84

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>UW163_RS15865 peptidase M48 (Ralstonia solanacearum UW163)
MPTFTAAFLIALVLMAATRLWLATRQIRHVSRHRDTVPTQFAESITLDMHHKAADYTIAR
TRLAMLEVPVQAALLIGLTLLGGLNWLNQAWLSVFGPGYAYGVALIASVIAISSLVELPF
SLYSQFVVEERFGFNRMTWKLWLADNLKGLAIGTALGLPLLLAVLWLMHSMGEHWWLYTW
VVWMAFTLFVQAIYPNVIAPLYNKFTPLEDGEMRTRIEGLLKRCGFASKGLFVMDGSRRS
AHGNAYFSGFGATKRIVFFDTLLARLDASEMEAVLAHELGHFKRHHITKRIAVMFVLSLG
LLALLGWLMTRTWFYLGLGVAPNLAADNHALALMLFFLALPVFMFFVSPLGSLSSRKHEF
EADAFAAQHADASRLVSALVKLFQDNASTLTPDPIYSAFYYSHPTASQRVARLVQAGA