Protein Info for UW163_RS15730 in Ralstonia solanacearum UW163

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 24 to 25 (2 residues), see Phobius details amino acids 35 to 53 (19 residues), see Phobius details amino acids 59 to 77 (19 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 116 to 138 (23 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 184 to 203 (20 residues), see Phobius details amino acids 215 to 235 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 290 (18 residues), see Phobius details PF05231: MASE1" amino acids 12 to 294 (283 residues), 200.7 bits, see alignment E=3.1e-63

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsc:RCFBP_20497)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>UW163_RS15730 membrane protein (Ralstonia solanacearum UW163)
MPFHRSSPSIAAALWGVLYVVAAVVSHRLNGPVDMTGYIWLPAGVAMAAFMLRPYREWPG
LGAAFAVGQLVLCAFEKGNPAHALLFVLDEAGSAALAVALVRLARVPLEGLDFVRAMLTA
GALSALLSALAGAAWFAWSQDASFGQVLRIWAASDFLGVLIVTPVLATWSRFRALRSGGP
DRNEILLGLAACVALAVSAYLVFEGNSTTRFGTGISRALTYVPLFFTVVVALLWGGRGGS
AAVLALAVLVETAEGDGPFAVLDRHYGQSLLEAQLYLGITALLVLLVSALKTSREQLHAQ
SAQWQSRVELALAAASQLVYTIDPARGRIDWGGDVELLFGHAPATMASVATVLQLVHPDD
RETLRARWLGAAPADVDATPARRQTLQVTARDGTLHTVIDSGTALADAAGNTVLIAGAWS
VETAR