Protein Info for UW163_RS15335 in Ralstonia solanacearum UW163

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 25 to 47 (23 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 93 to 221 (129 residues), 75.3 bits, see alignment E=2.4e-25 PF13188: PAS_8" amino acids 97 to 148 (52 residues), 21 bits, see alignment 9.7e-08 PF00989: PAS" amino acids 98 to 211 (114 residues), 48 bits, see alignment E=4.6e-16 PF24820: Diguanyl_cycl_sensor" amino acids 103 to 210 (108 residues), 31.2 bits, see alignment E=7.4e-11 PF08448: PAS_4" amino acids 105 to 216 (112 residues), 40.8 bits, see alignment E=9.2e-14 PF13426: PAS_9" amino acids 108 to 213 (106 residues), 40.1 bits, see alignment E=1.5e-13 PF07730: HisKA_3" amino acids 242 to 310 (69 residues), 55.7 bits, see alignment E=2.4e-18 PF02518: HATPase_c" amino acids 351 to 442 (92 residues), 41.9 bits, see alignment E=4.9e-14

Best Hits

KEGG orthology group: None (inferred from 85% identity to rsc:RCFBP_11533)

Predicted SEED Role

"Signal transduction histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (451 amino acids)

>UW163_RS15335 histidine kinase (Ralstonia solanacearum UW163)
MMTGHKAHPATTSLSRLSQRDSTPVELATGGLAMVLLFVSAVWLVLAASPRAGGATVLLL
AVASTAAGLALVFSWLRLRTLRVAAAHDLAGLEKSEARLAGIIRSSMEAILSVDERQRIV
LFNPMAEILFGCPASHAIGRPLSDFIPERFRSAHEAHVRRFGVTGVSERQMGKQRALFAL
HADGREFPIEASISQIDDGGSTLFTVMLRDITERVRAEAALRRSQEELQHLSDSILAARE
EERHRIARELHDDLGQRLSALKMDITLLAADIRAADGTSPFTAQTDAMQRVIDDTIAAVR
QISADLRPPLLDELGLVPAIEWIAKAFRQRFGLIINVRAHEASMDERAAISVFRIVQEAL
NNVVRHADATRVEIAFEHSDGMFALSVQDNGRGWNGTPPTEGGRKPLGLLGIRERARLLG
GQATVTQTPHGGFCLAVRFPDRHEAAQEVGQ