Protein Info for UW163_RS13840 in Ralstonia solanacearum UW163

Annotation: EamA/RhaT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 36 to 57 (22 residues), see Phobius details amino acids 77 to 102 (26 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 154 to 172 (19 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details PF00892: EamA" amino acids 3 to 137 (135 residues), 38.9 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsl:RPSI07_1933)

Predicted SEED Role

"FIG006442: Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (310 amino acids)

>UW163_RS13840 EamA/RhaT family transporter (Ralstonia solanacearum UW163)
MGIGVLCALLAGAMWGMVFIAPRALPAFSPWELTLGRYLAYGAIAALAASPILPRIARKI
TRADCLALVRQSCSGNLVYYVLLAFGVQLAGVAPVSLIIGVLPITVTVLGRRDHGAAPLS
RLIWPLLVVAAGIACINIDLFGHDAADARPVWQRIAGIACAAGALCSWTWYAVDNARYLQ
RNPHFSSNEWSALYGISTGALSAVLTAAAVLVAGTGWAQGGGRVWTTFWIVNAAVALGAS
LIGNNPWNIAARRLPLTLSGQMIVFETLFALAYGFVYDHRWPRPLEMAAIALLIAGVGWS
VRLHADDNSA