Protein Info for UW163_RS13765 in Ralstonia solanacearum UW163

Annotation: acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 TIGR01852: acyl-[acyl-carrier-protein]-UDP-N-acetylglucosamine O-acyltransferase" amino acids 7 to 270 (264 residues), 337 bits, see alignment E=3e-105 PF00132: Hexapep" amino acids 108 to 140 (33 residues), 37.1 bits, see alignment 1.7e-13 PF13720: Acetyltransf_11" amino acids 179 to 270 (92 residues), 84.3 bits, see alignment E=6.3e-28

Best Hits

Swiss-Prot: 96% identical to LPXA_RALSO: Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (lpxA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00677, UDP-N-acetylglucosamine acyltransferase [EC: 2.3.1.129] (inferred from 98% identity to rsc:RCFBP_20017)

MetaCyc: 53% identical to acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (Escherichia coli K-12 substr. MG1655)
Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase. [EC: 2.3.1.129]

Predicted SEED Role

"Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase (EC 2.3.1.129)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.129)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.129

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>UW163_RS13765 acyl-ACP--UDP-N-acetylglucosamine O-acyltransferase (Ralstonia solanacearum UW163)
MTQVQKIHPTAVIDPQAELASDVEVGAFTVIGPNVRIDSGTRIGHHTVVEGHTTLGRDNR
IGHFASVGGRPQDMKYRDEPTRLIVGDRNTIREFTTIHTGTAQDVGVTSIGDDNWIMAYV
HIAHDCRVGNHTVFSSNAQIAGHVEVGDWAILGGMSGVHQFVRIGAHAMLGGASALVQDV
PPFVIAASDKGGNKAAPHGVNVEGLRRRGFSAEQIAGLRQAYKLLYKSDLSFDQAQAELA
EQVIQTEDAPSREVLRTFADFIAATKRGIVR