Protein Info for UW163_RS13425 in Ralstonia solanacearum UW163

Annotation: sulfate ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 370 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 3 to 241 (239 residues), 398.3 bits, see alignment E=5.6e-124 PF00005: ABC_tran" amino acids 18 to 164 (147 residues), 137.1 bits, see alignment E=1.3e-43 PF17850: CysA_C_terminal" amino acids 241 to 289 (49 residues), 37.1 bits, see alignment 7.6e-13 PF12857: TOBE_3" amino acids 294 to 351 (58 residues), 55.3 bits, see alignment E=9.5e-19

Best Hits

Swiss-Prot: 93% identical to CYSA_RALSO: Sulfate/thiosulfate import ATP-binding protein CysA (cysA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 98% identity to rsc:RCFBP_20082)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (370 amino acids)

>UW163_RS13425 sulfate ABC transporter ATP-binding protein (Ralstonia solanacearum UW163)
MSIQVQHVTKRFGNFVALDDVSLDFKQGELTALLGPSGCGKTTLLRIIAGLEHADAGTIR
LNGEDASDQHVRERQVGFVFQHYALFKHMTVFENVAFGLRVKPRAQRPSEAQIRAKVKEL
LELVQLDWLADRYPPQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAKVRKELRRWLR
RLHDDLHVTSLFVTHDQEEALEVADNVVLMNRGQVEQVGSPDAVYNTPATPFVYGFLGNV
NLFHGRLEEAGGTSVLHVGESAITVPSGGVDAVRADQAVAFVRPHEIDLERYAPGAEGIP
VTLRRALTLGAIAQLELERTDSDDIIEVSLPIERFRAQGLREGETLVVRPRAIRVFAQGG
GRAASAQTVA