Protein Info for UW163_RS13160 in Ralstonia solanacearum UW163

Annotation: translational GTPase TypA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 TIGR01394: GTP-binding protein TypA/BipA" amino acids 4 to 599 (596 residues), 950.3 bits, see alignment E=3.3e-290 PF00009: GTP_EFTU" amino acids 4 to 194 (191 residues), 190.4 bits, see alignment E=6.3e-60 TIGR00231: small GTP-binding protein domain" amino acids 5 to 153 (149 residues), 81.3 bits, see alignment E=6.8e-27 PF01926: MMR_HSR1" amino acids 7 to 128 (122 residues), 24.8 bits, see alignment E=5e-09 PF03144: GTP_EFTU_D2" amino acids 218 to 289 (72 residues), 34.5 bits, see alignment E=5.6e-12 PF00679: EFG_C" amino acids 396 to 477 (82 residues), 79.9 bits, see alignment E=2.9e-26 PF21018: BipA_C" amino acids 485 to 593 (109 residues), 161.9 bits, see alignment E=1e-51

Best Hits

Swiss-Prot: 65% identical to TYPA_ECOLI: GTP-binding protein TypA/BipA (typA) from Escherichia coli (strain K12)

KEGG orthology group: K06207, GTP-binding protein (inferred from 100% identity to rsc:RCFBP_20130)

Predicted SEED Role

"GTP-binding protein TypA/BipA" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>UW163_RS13160 translational GTPase TypA (Ralstonia solanacearum UW163)
MRALRNIAIIAHVDHGKTTLVDQLLRQAGTFRENEQIAERVMDSNDIEKERGITILAKNC
AVEYNGTHINIVDTPGHADFGGEVERVLSMVDGVLLLVDAVEGPMPQTRFVTRKALALGL
KPIVVINKVDRPGARPEWVINQTFDLFDKLGANDDQLDFPVVYASGLNGYAGLTDDVREG
DMKPLFETILDKVPQRNDDPNGPFQLQIISLDYSSYVGKIGVGRITRGRVRPLQDVVVKF
GPDGAPIKGRVNQVLKFRGLEREIVQEAEAGDIVLINGIEELGIGCTVCAPDAQDALPML
KVDEPTLTMNFCVNTSPLAGREGKFVTSRQLRDRLDRELKSNVALRVKDTGDDTIFEVSG
RGELHLTILVENMRREGYELAVSRPRVVFKDIDGVKHEPFERLTVDVEDGHQGGVMEELG
RRKGELLDMASDGKGRTRLEYRIPARGLIGFQGEFLTLTRGTGLISHIFDDYSPVKEGDL
GERHNGVLISQDDGAAVAYALWKLQDRGRMFVSPGDALYEGMIIGIHSRDNDLVVNPIKG
KQLTNVRASGTDEAVRLVPPIQMSLEYAVEFIADDELVEVTPKSIRLRKRHLKEHERKRA
AREEAV