Protein Info for UW163_RS12970 in Ralstonia solanacearum UW163

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 78 to 106 (29 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 224 to 250 (27 residues), see Phobius details PF07264: EI24" amino acids 8 to 218 (211 residues), 106.1 bits, see alignment E=1.4e-34

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_20174)

Predicted SEED Role

"Probable transmembrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (286 amino acids)

>UW163_RS12970 membrane protein (Ralstonia solanacearum UW163)
MNDLVRSFGRALLSQLHPRMLFMTVLPFIAALVVWGPILYFGWNPVMEMARGVLEGWALT
HWIYSGLDALGMTGFRAVIAPLVVIAALVPVIVVTILVFVGAASVPAVMRFLDRNYPQLE
RRQGGSVAGSLLHSLGCTLVFAVVAVVTLPLWLIPPFFALIPPLLWGWLTYRVMTYDALA
DHASADERRIIMQRYRLPLLGIGVAVGMLGSAPTLLWVSSVVTIVLFPIIAIAVIWLYVL
IFIFSALWFGHFCLRALTRLRAEAPPPTRVIESTVIDVTVIERPLE