Protein Info for UW163_RS12905 in Ralstonia solanacearum UW163

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 519 transmembrane" amino acids 455 to 471 (17 residues), see Phobius details PF00005: ABC_tran" amino acids 40 to 190 (151 residues), 104.8 bits, see alignment E=6e-34 amino acids 290 to 443 (154 residues), 80.1 bits, see alignment E=2.5e-26

Best Hits

Swiss-Prot: 61% identical to RGMG_RALSO: Putative ribose/galactose/methyl galactoside import ATP-binding protein (RSc1242) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 98% identity to rsc:RCFBP_20187)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (519 amino acids)

>UW163_RS12905 sugar ABC transporter ATP-binding protein (Ralstonia solanacearum UW163)
MPMTLSPLAPPPDTVVPTATRDALLHASGLCKAFAGVTALDNVGLSVHAGRVHALMGENG
AGKSTMMKILSGVYLADRGALYKHGRPLQLRSPRDALRHGIAMIHQELNLLPDMTVAENI
WIGREPRNPLGLVDHGELRRRTAQLLSRLEIHIDPDTELGDLSIASRQMIEIAKAVSCES
DLLIMDEPTSAITDREVEHLFRIIAELKRAGKAIIYITHKMDEVFRIADDVSVLRDGRYV
AGGPANGFDHAALITAMVGRELSEIYPKVDVAPGEVVLAVRGLTRRGVYRDVSFEVRAGE
VLGVAGLMGSGRTEVMESLFGIVPADAGEVHLDGARVQLRHPGDAIARGMAFLTEDRKKS
GAFLSLSVGCNMEISALGRHCTAGFVRQHEMTRKCEAMRRQLRIKTPSLDEAIENLSGGN
QQKVLIARWLLNTPRVLILDEPTRGIDIGAKAEIYRLIGMLAQSGVAIIMVSSELPEVMG
MSDRILVMHQGSVGGLLARPDFSQERIMALASGVRTFDL