Protein Info for UW163_RS12885 in Ralstonia solanacearum UW163

Annotation: Rieske family ferredoxin

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 103 PF13806: Rieske_2" amino acids 3 to 101 (99 residues), 43.2 bits, see alignment E=3.4e-15 PF00355: Rieske" amino acids 3 to 88 (86 residues), 64.6 bits, see alignment E=6.6e-22 TIGR02377: Rieske [2Fe-2S] domain protein, MocE subfamily" amino acids 3 to 102 (100 residues), 143 bits, see alignment E=1.3e-46

Best Hits

Swiss-Prot: 40% identical to NDOA_PSEAI: Naphthalene 1,2-dioxygenase system, ferredoxin component (ndoA) from Pseudomonas aeruginosa

KEGG orthology group: K05710, ferredoxin subunit of phenylpropionate dioxygenase (inferred from 97% identity to rsc:RCFBP_20191)

MetaCyc: 38% identical to naphthalene 1,2-dioxygenase complex ferredoxin component (Pseudomonas sp. NCIB9816-4)
Naphthalene 1,2-dioxygenase. [EC: 1.14.12.12]

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (103 amino acids)

>UW163_RS12885 Rieske family ferredoxin (Ralstonia solanacearum UW163)
MPQWIPVCSLDEIDDEDVLRFDHGGRTYAVYRYDNQVYASAGLCTHERVHLADGLLMEYV
IECPKHNGRFDIRDGRALGAPVCEHLRTHRARVEDGVVQVELD