Protein Info for UW163_RS12820 in Ralstonia solanacearum UW163

Annotation: NAD-dependent deacylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02146: SIR2
  • amino acids 29 to 200 (172 residues), 157.4 bits, E=1.9e-50

Best Hits

Swiss-Prot: 94% identical to NPD_RALSO: NAD-dependent protein deacylase (cobB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K12410, NAD-dependent deacetylase [EC: 3.5.1.-] (inferred from 96% identity to rsc:RCFBP_20203)

Predicted SEED Role

"NAD-dependent protein deacetylase of SIR2 family" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate or Redox-dependent regulation of nucleus processes

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.-

Protein Sequence (247 amino acids)

>UW163_RS12820 NAD-dependent deacylase (Ralstonia solanacearum UW163)
MPTVASDAAALAQARTWIEAAGRVMVLTGAGVSAESGVPTFRDALTGLWARFNPEDLATE
AAYREHPGVVWDWYQERRERVSQVQPNPAHLAIAALARRKTVTLVTQNVDGLHQRAGSEG
VIELHGNLFANKWLGGCGKCDVATAELGSPPRCAACGAMLRPGVVWFGERLPVVANYRAE
EAANTCDVCLVVGTSGMVYPAAGLPGLAKDHGARIIVVNPEPSVLDETADLVIHQPAGVC
LPAMLAA