Protein Info for UW163_RS11865 in Ralstonia solanacearum UW163

Annotation: septum formation protein Maf

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 198 TIGR00172: septum formation protein Maf" amino acids 7 to 190 (184 residues), 154.6 bits, see alignment E=1e-49 PF02545: Maf" amino acids 8 to 191 (184 residues), 174.5 bits, see alignment E=9.7e-56

Best Hits

Swiss-Prot: 97% identical to NTPPB_RALSO: 7-methyl-GTP pyrophosphatase (RSc1046) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06287, septum formation protein (inferred from 97% identity to rsl:RPSI07_2348)

MetaCyc: 51% identical to m7GTP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
RXN0-7079

Predicted SEED Role

"FIG146278: Maf/YceF/YhdE family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (198 amino acids)

>UW163_RS11865 septum formation protein Maf (Ralstonia solanacearum UW163)
MTHATRPPLILASSSPYRRELLERLRLPFEIVVPDIDETPATGESPDQTALRLARQKAEK
IAAAHTGTLVIGSDQVATLDGKQVGKPGDHARALAQLHWMRGRTVTFHSALCLYDGRTGQ
HQSEDVRTLATFRNLSDEELDAYLHLEHPYDVAGSAKSEGLGIALLERVESPDPTALVGL
PLIALTTMLRNVHYPLFG