Protein Info for UW163_RS11715 in Ralstonia solanacearum UW163

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 523 PF00005: ABC_tran" amino acids 26 to 175 (150 residues), 109.6 bits, see alignment E=2e-35 amino acids 281 to 436 (156 residues), 69.5 bits, see alignment E=4.8e-23

Best Hits

Swiss-Prot: 46% identical to RGMG1_BURCM: Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 (Bamb_1228) from Burkholderia ambifaria (strain ATCC BAA-244 / AMMD)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 98% identity to rsc:RCFBP_20464)

Predicted SEED Role

"Ribose ABC transport system, ATP-binding protein RbsA (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (523 amino acids)

>UW163_RS11715 sugar ABC transporter ATP-binding protein (Ralstonia solanacearum UW163)
MTTASAPRTPLLRASALSKHYAAPVLRDVDLDVYAGEVLALTGENGAGKSTLSKILCGLE
TPTSGSMSLAGHLFVPASRCDAENLGVRMVLQELSMVPTLTVAENLFLGNLPRRCGWIDR
SALQRRAEQALAQVGLHLDPRLPVHMLGIGHRQMIEIARALTSTCRVLVLDEPTAMLSAH
ESATLFARIDALRREGVAVVYISHRLDELARIADRIVVLRDGRLITDAPAATVTQDALIR
AMVGRELAAEPGPQRPARAPRPPDAAPALRVTGLTRAPAVRDVSFTVAQGEIFGIAGLVG
AGRTELLRLIFGADRAEAGTIEAGTPLAPLRIRAPGHAIRHGISLLTEDRKDEGLLLSLP
IAANIALGNMAGVTRRGWLQPARERALAQRHIEALRIRCAGPEQAAGELSGGNQQKVAIA
RWLERDTSVLLFDEPTRGVDVGAKFDIYALLETLAAQGKALVVVSSDLRELMQVCDRIGV
MRAGRLTQIFHRDGWSQDALLAAAFGECPPPSSTSSPETADAL