Protein Info for UW163_RS10910 in Ralstonia solanacearum UW163

Annotation: urease accessory protein UreF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01730: UreF
  • amino acids 52 to 198 (147 residues), 131.3 bits, E=1.8e-42

Best Hits

Swiss-Prot: 95% identical to UREF_RALSO: Urease accessory protein UreF (ureF) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03188, urease accessory protein (inferred from 98% identity to rsc:RCFBP_11358)

Predicted SEED Role

"Urease accessory protein UreF" in subsystem Urea decomposition

MetaCyc Pathways

• urea degradation II (1/1 steps found)
• superpathway of allantoin degradation in plants (4/8 steps found)

Protein Sequence (243 amino acids)

>UW163_RS10910 urease accessory protein UreF (Ralstonia solanacearum UW163)
MCTAPVAATRITTLMTSATQLTALLHLASPALPVGAFSYSQGLEAAVEARHVHDEASAAR
WIAEGLAVLAACEAPLWLLQYADWQAGRPDAVAERDGWFLATRETRELRLETAQMGWSLA
RLIAQMGWGDPAMRDALATRTTITFPTAFAAAAVAQGIEARDGLTAYGFAWVENQVAAAV
KAIPLGQSAGQRILFGLHAAVGRAAEEAARRAACHPPELSTFSPGLGVLSARHETQYSRL
FRS