Protein Info for UW163_RS10155 in Ralstonia solanacearum UW163

Annotation: methylglyoxal synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 TIGR00160: methylglyoxal synthase" amino acids 13 to 133 (121 residues), 176.5 bits, see alignment E=1.5e-56 PF02142: MGS" amino acids 28 to 120 (93 residues), 59.8 bits, see alignment E=1.2e-20

Best Hits

Swiss-Prot: 93% identical to MGSA_RALSO: Methylglyoxal synthase (mgsA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01734, methylglyoxal synthase [EC: 4.2.3.3] (inferred from 98% identity to rsc:RCFBP_11211)

Predicted SEED Role

"Methylglyoxal synthase (EC 4.2.3.3)" in subsystem Methylglyoxal Metabolism (EC 4.2.3.3)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>UW163_RS10155 methylglyoxal synthase (Ralstonia solanacearum UW163)
MTTITPEGPLPKRRRIALIAHDHKKDDMIAFAQTHRAFLSECDLLATGTTGGRLQNEVGL
NVQRLLSGPWGGDLQIGAQLAEGRVDAVIFLRDPMTPQPHEPDINALVRACDVHNIPCAT
NLATADLVMVALSLAQPDPKEIHA