Protein Info for UW163_RS09820 in Ralstonia solanacearum UW163
Annotation: 3-oxoadipate enol-lactonase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 44% identical to ELH2_ACIAD: 3-oxoadipate enol-lactonase 2 (catD) from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1)
KEGG orthology group: K01055, 3-oxoadipate enol-lactonase [EC: 3.1.1.24] (inferred from 97% identity to rsc:RCFBP_11145)MetaCyc: 50% identical to subunit of 3-oxoadipate enol-lactone hydrolase (Pseudomonas putida)
3-oxoadipate enol-lactonase. [EC: 3.1.1.24]
Predicted SEED Role
"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)
MetaCyc Pathways
- aromatic compounds degradation via β-ketoadipate (9/9 steps found)
- superpathway of salicylate degradation (7/7 steps found)
- catechol degradation III (ortho-cleavage pathway) (6/6 steps found)
- catechol degradation to β-ketoadipate (4/4 steps found)
- protocatechuate degradation II (ortho-cleavage pathway) (4/4 steps found)
- toluene degradation III (aerobic) (via p-cresol) (7/11 steps found)
- 4-methylcatechol degradation (ortho cleavage) (4/7 steps found)
- mandelate degradation to acetyl-CoA (9/18 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (17/35 steps found)
- superpathway of aerobic toluene degradation (10/30 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 3.1.1.24
Use Curated BLAST to search for 3.1.1.24
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (270 amino acids)
>UW163_RS09820 3-oxoadipate enol-lactonase (Ralstonia solanacearum UW163) MPWLEHDNVRLYHEFDDRHASAKPVLVLSNSLGTHLGMWAPQLEALRRHFRLVRYDTRGH GQSSVPDAPFGVAQLGGDVLALLDHYDIELALFCGLSMGGLTGLWLAAHHGERFPRMVVS NTAALIGTPQSWNARIAQVEQGGMAGITGTVLERWFTDGYRVAAPERVDLVKAMLLATPP AGYNGNCAAIRDADLRAQLQDIRVPLLAIGGTHDISTPAAQTRAIAQGVPGAQYVELSAG HLANWEQAEAYTDALIGFLTTGVAREAAHG