Protein Info for UW163_RS09555 in Ralstonia solanacearum UW163

Annotation: ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 TIGR00229: PAS domain S-box protein" amino acids 33 to 138 (106 residues), 40.9 bits, see alignment E=1e-14 PF08448: PAS_4" amino acids 45 to 146 (102 residues), 64.6 bits, see alignment E=2.3e-21 PF00989: PAS" amino acids 46 to 140 (95 residues), 31.9 bits, see alignment E=2.9e-11 PF13426: PAS_9" amino acids 47 to 140 (94 residues), 30.9 bits, see alignment E=7e-11 PF07730: HisKA_3" amino acids 180 to 247 (68 residues), 53.8 bits, see alignment E=5.8e-18 PF02518: HATPase_c" amino acids 291 to 378 (88 residues), 48.8 bits, see alignment E=2.2e-16

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 89% identity to rso:RSc2311)

Predicted SEED Role

"putative PAS/PAC sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (383 amino acids)

>UW163_RS09555 ATPase (Ralstonia solanacearum UW163)
MKPSSQRDGRHLHLTWRDVIDAVRKLTTTIRPNEQNFDAAADVRGAAFCILSPDGHFVSA
NGSAGAIFGYSGNELIGRSLLDMTANGGRQDILDGLSRCAAGTFHSFQAQLCVRGGRHAP
MLLHQHPIFDSDGCVGALLTIFEEPSTSERVASDSAGGLLAAESDAKRQYAFLMIGQERE
RKRISSELHDGLGQALTLIKLTVEDALIHIHRNNIAEATELLDTAVLRIRESIGDVRRIC
CELRPALLDRLGLAASLDALCKRVEEGAGHLAVRFDCGLEDEEVPDNLKADIFRITQEAM
NNAIRHGAATEIRLGLRRIEAGILLTIQDNGIGFDTQPLFADPVSQSGLGLIGMQQRVEL
NGGSFFIQSSVGDGTLVSALWRA