Protein Info for UW163_RS09510 in Ralstonia solanacearum UW163

Annotation: DNA translocase FtsK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 785 transmembrane" amino acids 28 to 48 (21 residues), see Phobius details amino acids 70 to 93 (24 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 172 to 199 (28 residues), see Phobius details PF13491: FtsK_4TM" amino acids 23 to 206 (184 residues), 161.2 bits, see alignment E=4e-51 PF17854: FtsK_alpha" amino acids 284 to 384 (101 residues), 106.9 bits, see alignment E=1.1e-34 PF01580: FtsK_SpoIIIE" amino acids 392 to 601 (210 residues), 239.8 bits, see alignment E=5e-75 PF09397: FtsK_gamma" amino acids 714 to 774 (61 residues), 90 bits, see alignment 1.3e-29

Best Hits

Swiss-Prot: 97% identical to FTSK2_RALSO: DNA translocase FtsK 2 (ftsK2) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 99% identity to rsc:RCFBP_11091)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (785 amino acids)

>UW163_RS09510 DNA translocase FtsK (Ralstonia solanacearum UW163)
MARASTTPTTRTDPAALPSRIGRLLGEVRWFLLLAATIAFLTILLSYNKADPGWSHASQV
DDVRNLGGRVGAWFADVLLFVFGASAYWWALLLVRRVWRGWRELMSDERLPPHHATSATP
RVDAGVTWIGFALILAASMGLEAIRMHTLHMKLPRAPGGVLGDLIGGSLQHALGFTGGTL
MLLLMFTVGLSLFFHFSWLNLAEQIGAGVEMLFVGFKTRRENKQDRAIGEAAKVEREEVV
ETRRVRIEEAPPVQIVRPTAVVKSERVEREKQQPLFVDIQDSDLPPLALLDPIPPVQETV
SAETLEFTSRLIEKKLKDFGVEVQVVAAYPGPVITRYEIEPATGVKGSQIVNLAKDLARS
LSLVSIRVVETIPGKNFMGLELPNPKRQSVRLSEILGSQVYNESASQLTMALGKDIAGKP
VVADLAKMPHCMVAGTTGSGKSVGINAMILSLLYKARADAVRLILIDPKMLELSIYEGIP
HLLCPVVTDMRQAGHALNWAVGEMERRYKLMSKMGVRNLAGFNKKIEEAAAREEKIPNPF
SLTPDAPEPLDKLPMIVIVIDELADLMMVVGKKVEELIARIAQKARAAGIHLVLATQRPS
VDVITGLIKANVPTRIAFQVSSKIDSRTILDQQGAEALLGMGDMLYLAPGTGLPVRVHGA
FVSDDEVHRVVENLKSQGEPNYIEGLLEGGTADGEGGGDGFGGGAGLAGGGAGEADPLYD
QAVDVVLKNRRASISLVQRHLRIGYNRAARLLEDMEKAGLVSAMSGNGNREILAPNRNGN
VVEEE