Protein Info for UW163_RS09495 in Ralstonia solanacearum UW163

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03458: Gly_transporter
  • amino acids 12 to 82 (71 residues), 76.3 bits, E=7e-26
  • amino acids 100 to 173 (74 residues), 76.2 bits, E=7.1e-26

Best Hits

Swiss-Prot: 37% identical to YADS_AERCA: UPF0126 membrane protein (yadS) from Aeromonas caviae

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_11088)

Predicted SEED Role

"putative membrane protein"

Protein Sequence (207 amino acids)

>UW163_RS09495 trimeric intracellular cation channel family protein (Ralstonia solanacearum UW163)
MHESRLLLVMHWMEILAVFSFAVSGLAEARRHRLDAVGAFIVAFLTAFGGGTLRDLLLDR
RPFYWVEHEQYLLALFVMSLFANRVIRLVSQLVSDRVLVVADAIGLGLFGVLGTQLALDA
GVPVFVSVMMGVITAAFGGLLRDVVCNEVPMLLRDNRPYATCVFLGCFFYVGLTRTSLLP
SVAVVVATLAIVVGRLATLRWNITLPR