Protein Info for UW163_RS09390 in Ralstonia solanacearum UW163

Annotation: argininosuccinate lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00838: argininosuccinate lyase
  • amino acids 12 to 469 (458 residues), 604.1 bits, E=9.5e-186
• PF00206: Lyase_1
  • amino acids 15 to 308 (294 residues), 256.6 bits, E=3.7e-80
• PF14698: ASL_C2
  • amino acids 371 to 445 (75 residues), 86.1 bits, E=1.9e-28

Best Hits

Swiss-Prot: 96% identical to ARLY_RALSO: Argininosuccinate lyase (argH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K01755, argininosuccinate lyase [EC: 4.3.2.1] (inferred from 98% identity to rsc:RCFBP_11067)

MetaCyc: 42% identical to argininosuccinate lyase (Homo sapiens)
Argininosuccinate lyase. [EC: 4.3.2.1]

Predicted SEED Role

"Argininosuccinate lyase (EC 4.3.2.1)" in subsystem Arginine Biosynthesis extended (EC 4.3.2.1)

MetaCyc Pathways

• superpathway of arginine and polyamine biosynthesis (16/17 steps found)
• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• superpathway of L-citrulline metabolism (10/12 steps found)
• urea cycle (4/5 steps found)
• nitric oxide biosynthesis II (mammals) (2/3 steps found)
• canavanine biosynthesis (2/4 steps found)
• L-arginine biosynthesis IV (archaea) (4/9 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.2.1

Protein Sequence (471 amino acids)

>UW163_RS09390 argininosuccinate lyase (Ralstonia solanacearum UW163)
MTSQLAKKAEAWSARFNEPVSDLVKRYTASVFFDKRLALFDIQGSLAHAAMLAKQGIIAE
ADRAAIERGMAQIRQEIESGVFEWKLDLEDVHLNIEARLTALTGDAGKRLHTGRSRNDQV
ATDIRLWLRSEIDSIVGLLKALRGALLDLAEQHAGTIVPGFTHLQVAQPVTFGHHLLAYV
EMFTRDTERMLDARRRVNRLPLGAAALAGTSYPIDRDFVAQQLGFDGVCRNSLDAVSDRD
FAIEFCAAAALVMTHISRFSEELVLWMSPRVGFIDIADRFCTGSSIMPQKKNPDVPELAR
GKTGRVNGHLIGLLTLMKGQPLAYNKDNQEDKEPLFDTVDTVADTLRIFADMVPGITVKA
DAMRAAALQGYATATDLADYLVKRGLPFRDAHEAVAHAVRACDDLRCDLADLSVAQLREI
SGLGDKADLISDDVHAVLTLEGSVASRNHIGGTAPEQVKLAIAAARAALAD