Protein Info for UW163_RS09210 in Ralstonia solanacearum UW163

Annotation: threonine-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01140: threonine-phosphate decarboxylase
  • amino acids 11 to 339 (329 residues), 349 bits, E=1.3e-108
• PF00155: Aminotran_1_2
  • amino acids 60 to 314 (255 residues), 93.1 bits, E=1.1e-30

Best Hits

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 95% identity to rsc:RCFBP_11029)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (29/33 steps found)
• adenosylcobalamin biosynthesis I (anaerobic) (29/36 steps found)
• superpathway of L-threonine metabolism (13/18 steps found)
• aminopropanol phosphate biosynthesis I (1/2 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Protein Sequence (350 amino acids)

>UW163_RS09210 threonine-phosphate decarboxylase (Ralstonia solanacearum UW163)
MSADARFTIAHGGNLAAARARYDEPSGGWVDLSTGINPHGYPVPPIPPEAWLRLPEDDGL
EAAAAAHYGVANADAILAVAGSQAAIRALPLLLPRGRVGMARIGYSEYAPAFARAGHDVV
LLEERDFFDADLTDTLTHLVVVNPNNPTARGLPADTLRDWHARLHARGGTLLVDEAFVET
LDAPPSLAPLAGAPGLIVLRSIGKFYGLAGARIGFVLGPAARLAALREALGHWTVNGPAR
AVVRTALANTAWQADTRARLQREGARLSALLARHGLPNASTPLFAWVPTPDAAAVHAALA
QRGLWTRLFDAPGTPPVQGLRFGLPPDAVGWQRLDDALASLSLSSTSALR