Protein Info for UW163_RS09210 in Ralstonia solanacearum UW163

Annotation: threonine-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 TIGR01140: threonine-phosphate decarboxylase" amino acids 11 to 339 (329 residues), 349 bits, see alignment E=1.3e-108 PF00155: Aminotran_1_2" amino acids 60 to 314 (255 residues), 93.1 bits, see alignment E=1.1e-30

Best Hits

KEGG orthology group: K02225, cobalamin biosynthetic protein CobC (inferred from 95% identity to rsc:RCFBP_11029)

Predicted SEED Role

"L-threonine 3-O-phosphate decarboxylase (EC 4.1.1.81)" in subsystem Cobalamin synthesis or Coenzyme B12 biosynthesis (EC 4.1.1.81)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.81

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>UW163_RS09210 threonine-phosphate decarboxylase (Ralstonia solanacearum UW163)
MSADARFTIAHGGNLAAARARYDEPSGGWVDLSTGINPHGYPVPPIPPEAWLRLPEDDGL
EAAAAAHYGVANADAILAVAGSQAAIRALPLLLPRGRVGMARIGYSEYAPAFARAGHDVV
LLEERDFFDADLTDTLTHLVVVNPNNPTARGLPADTLRDWHARLHARGGTLLVDEAFVET
LDAPPSLAPLAGAPGLIVLRSIGKFYGLAGARIGFVLGPAARLAALREALGHWTVNGPAR
AVVRTALANTAWQADTRARLQREGARLSALLARHGLPNASTPLFAWVPTPDAAAVHAALA
QRGLWTRLFDAPGTPPVQGLRFGLPPDAVGWQRLDDALASLSLSSTSALR