Protein Info for UW163_RS09085 in Ralstonia solanacearum UW163

Annotation: sulfate adenylyltransferase subunit CysD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02039: sulfate adenylyltransferase, small subunit
  • amino acids 20 to 316 (297 residues), 397.5 bits, E=2.3e-123
• PF01507: PAPS_reduct
  • amino acids 41 to 269 (229 residues), 146.9 bits, E=3.2e-47

Best Hits

Swiss-Prot: 62% identical to CYSD_MYCTU: Sulfate adenylyltransferase subunit 2 (cysD) from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)

KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 99% identity to rso:RSc2422)

MetaCyc: 68% identical to sulfate adenylyltransferase small subunit (Allochromatium vinosum)
Sulfate adenylyltransferase. [EC: 2.7.7.4]

Predicted SEED Role

"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)

MetaCyc Pathways

• superpathway of L-methionine biosynthesis (by sulfhydrylation) (12/12 steps found)
• superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
• assimilatory sulfate reduction I (4/4 steps found)
• assimilatory sulfate reduction III (3/3 steps found)
• sulfate activation for sulfonation (2/2 steps found)
• assimilatory sulfate reduction IV (3/4 steps found)
• assimilatory sulfate reduction II (2/3 steps found)
• superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (7/10 steps found)
• sulfite oxidation III (1/3 steps found)
• selenate reduction (2/5 steps found)
• superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (2/6 steps found)
• dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
• superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
• superpathway of sulfide oxidation (phototrophic sulfur bacteria) (4/12 steps found)
• superpathway of seleno-compound metabolism (6/19 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Selenoamino acid metabolism
• Sulfur metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.4

Use Curated BLAST to search for 2.7.7.4

Protein Sequence (316 amino acids)

>UW163_RS09085 sulfate adenylyltransferase subunit CysD (Ralstonia solanacearum UW163)
MGVLNEIPGTALTPMQNDHLDWLEAESIYIIREVVAECRNPALLFSGGKDSIVMLHLALK
AFRLGDRKIELPFPLVHIDTGHNYQEVIAFRDQRVAELGARLVVGHVEDSIKRGTVRLRK
ETDSRNAAQAVTLLETIESHGFDALMGGARRDEEKARAKERIFSFRDEFGQWDPKAQRPE
LWSLYNARMARGEQMRVFPISNWTELDVWQYIARENLALPPIYYAHQREVVRKNGLLVPV
TPITPKADGDVSEVLSVRFRTVGDISCTCPVASTAATPAEIIAETAVTEITERGATRMDD
QTSEASMEKRKKEGYF