Protein Info for UW163_RS08980 in Ralstonia solanacearum UW163

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 67 to 88 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 153 to 170 (18 residues), see Phobius details amino acids 197 to 219 (23 residues), see Phobius details amino acids 225 to 244 (20 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 295 (288 residues), 167.3 bits, see alignment E=2e-53

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 100% identity to rsc:RCFBP_10986)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>UW163_RS08980 branched-chain amino acid ABC transporter permease (Ralstonia solanacearum UW163)
MDIFIQQIVNGLVLGSIYALIALGYTMVYGILGIINFAHGDVLMIGAMSALTAINFLQKF
FPHLPDWLTLVLALLFAMPVCAIVAYTIERVAYRPLRNAPRLAPLITAIGVSIVLQTLAM
MIWSRNPLTFPQLLPASPIDIGSTGATITGKEIAIILVSLAVMIGLTLLVNRTKLGRAMR
ATAENQRVAGLMGVNPNFVISATFMIGAAMAAVAGVMMATNYGNAHFYMGFIPGLKAFTA
AVLGGIGNLAGAMVGGVLLGLIEALGAGYIGDLTGGVFGSNYQDVFAFIVLICVLLFRPS
GIMGERVADRA