Protein Info for UW163_RS08940 in Ralstonia solanacearum UW163

Annotation: nicotinate-nucleotide diphosphorylase (carboxylating)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00078: nicotinate-nucleotide diphosphorylase (carboxylating)" amino acids 30 to 293 (264 residues), 280.2 bits, see alignment E=7.8e-88 PF02749: QRPTase_N" amino acids 38 to 126 (89 residues), 79.2 bits, see alignment E=1.9e-26 PF01729: QRPTase_C" amino acids 128 to 292 (165 residues), 181.8 bits, see alignment E=9.6e-58

Best Hits

Swiss-Prot: 55% identical to NADC_PSEAE: Nicotinate-nucleotide pyrophosphorylase [carboxylating] (nadC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K00767, nicotinate-nucleotide pyrophosphorylase (carboxylating) [EC: 2.4.2.19] (inferred from 98% identity to rsc:RCFBP_10978)

Predicted SEED Role

"Quinolinate phosphoribosyltransferase [decarboxylating] (EC 2.4.2.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.4.2.19)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>UW163_RS08940 nicotinate-nucleotide diphosphorylase (carboxylating) (Ralstonia solanacearum UW163)
MTATQMTASAAQATFDSFGSALRDALAANVAAAIGEDVGTGDRTGLLVPAERHARARVIV
REAAVLCGTPWFDACMRAVDPALRVTWLQHEGDRMAPDSGVCEIEGPARALLTAERPSLN
FLQLLSGVATATSRYAEAIAGTRACVLDTRKTLPGLRLAQKYAVRIGGGENQRLALYDGI
LIKENHIAAAGGVTAALRAAQALNAGVPIQIEVETLAQLEEALAAGATSVLLDNFDVPAM
REAVRVTAGRALLEVSGGVSIATIRAFAETGVDRISVGALTKDVRATDYSLRIIE