Protein Info for UW163_RS08885 in Ralstonia solanacearum UW163

Annotation: lipoprotein signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 174 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 84 to 102 (19 residues), see Phobius details amino acids 109 to 126 (18 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details TIGR00077: signal peptidase II" amino acids 29 to 171 (143 residues), 145.8 bits, see alignment E=5.5e-47 PF01252: Peptidase_A8" amino acids 29 to 169 (141 residues), 158.1 bits, see alignment E=8.2e-51

Best Hits

Swiss-Prot: 93% identical to LSPA_RALSO: Lipoprotein signal peptidase (lspA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03101, signal peptidase II [EC: 3.4.23.36] (inferred from 99% identity to rsc:RCFBP_10966)

MetaCyc: 45% identical to lipoprotein signal peptidase (Escherichia coli K-12 substr. MG1655)
Signal peptidase II. [EC: 3.4.23.36]

Predicted SEED Role

"Lipoprotein signal peptidase (EC 3.4.23.36)" in subsystem Sex pheromones in Enterococcus faecalis and other Firmicutes or Signal peptidase (EC 3.4.23.36)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.23.36

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (174 amino acids)

>UW163_RS08885 lipoprotein signal peptidase (Ralstonia solanacearum UW163)
MATRNNGKSKAAGGKSGGGGHGVGPWLGLAVIWILLDQLTKVAITKTFIYGESRPITGFF
NLVLAYNRGAAFSFLAAAGGWQRWFFTGLGVAAALFIVWLLRRHSGQKLFCFALALILGG
AVGNVIDRVIHGHVVDFLDFHLHGYHWPAFNVADCGICIGAVLLIIDELRRVRR