Protein Info for UW163_RS08460 in Ralstonia solanacearum UW163

Annotation: UDP-N-acetylmuramate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 TIGR00179: UDP-N-acetylenolpyruvoylglucosamine reductase" amino acids 12 to 338 (327 residues), 213.8 bits, see alignment E=1.6e-67 PF01565: FAD_binding_4" amino acids 26 to 158 (133 residues), 68.1 bits, see alignment E=6.6e-23 PF02873: MurB_C" amino acids 219 to 342 (124 residues), 92.5 bits, see alignment E=1.6e-30

Best Hits

Swiss-Prot: 96% identical to MURB_RALSO: UDP-N-acetylenolpyruvoylglucosamine reductase (murB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00075, UDP-N-acetylmuramate dehydrogenase [EC: 1.1.1.158] (inferred from 96% identity to rso:RSc2550)

Predicted SEED Role

"UDP-N-acetylenolpyruvoylglucosamine reductase (EC 1.1.1.158)" in subsystem Peptidoglycan Biosynthesis or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 1.1.1.158)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.158

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>UW163_RS08460 UDP-N-acetylmuramate dehydrogenase (Ralstonia solanacearum UW163)
MALLDPHYPLGRHNTFRFEAIARYAAHVRAPQDIAEALADPRVRGLPVLVLGGGSNIVLT
RDFDGLVLLVEIPGVQVGRATLDGRAVHTVTASAGESWHGLVAYTLSNGLPGLENLALIP
GTVGAAPIQNIGAYGVEIKDRFHSLRAYDRHAGEFVTLDAADCAFGYRDSLFKRAGADRY
VITEVTFALPVDWQPDTHYAELARELAARDIPAPAAQDIFDAVVAIRRRKLPDPAEIGNA
GSFFKNPIVDAATRDALLARFPGLVGYAQPDGGYKLAAGWMIDQCGFKGRQSGAVGVYDK
QALVLVHRGGGSAVQLMTLAREIQDTVHARFGVRIEPEPVVI