Protein Info for UW163_RS08395 in Ralstonia solanacearum UW163

Annotation: DNA mismatch repair endonuclease MutL

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 644 TIGR00585: DNA mismatch repair protein MutL" amino acids 14 to 314 (301 residues), 306.5 bits, see alignment E=1.4e-95 PF02518: HATPase_c" amino acids 33 to 89 (57 residues), 32.6 bits, see alignment 2e-11 PF13589: HATPase_c_3" amino acids 36 to 133 (98 residues), 45.1 bits, see alignment E=2.1e-15 PF01119: DNA_mis_repair" amino acids 217 to 333 (117 residues), 132.9 bits, see alignment E=9e-43 PF08676: MutL_C" amino acids 458 to 600 (143 residues), 161 bits, see alignment E=3.2e-51

Best Hits

Swiss-Prot: 94% identical to MUTL_RALSO: DNA mismatch repair protein MutL (mutL) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03572, DNA mismatch repair protein MutL (inferred from 99% identity to rsc:RCFBP_10835)

Predicted SEED Role

"DNA mismatch repair protein MutL" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (644 amino acids)

>UW163_RS08395 DNA mismatch repair endonuclease MutL (Ralstonia solanacearum UW163)
MTANPAAAAPARRPIRPLPDQLISQIAAGEVVERPASVVKELLENALDAGATQLQIKLEE
GGVRRIAITDNGGGIPVDELPVALMRHATSKIGSLEELESVATLGFRGEALASIASVAEL
TLTSRTADAAHATQILAQSGRIQPASGGVGTTVDVQHLYFNTPARRKFLKSEQTELGHCL
EVIRRTALARPDVAISVHHNGKPLEHWNAAQADTRTAAVLGTEFARARLPFEEAAGELRL
FGFAGLPTASRGRADHQFFYVNGRFVRDRLLTHAVRSAYEDVLHGDRFPAYVLCLELPPE
AVDVNVHPSKIEVRFRDSRAVHQFVYHAVQRALSRHAGEQGDSLRTDIAEAADAPGQPGT
AATPAPADNTTRWINQMAARQTSLGIAQPRAEYLAMMRGSSTPLPSSRPAWMADVPSAAT
LFDGAAANADEAPVQAAVPVAAPQTDEADDAHPLGFAIAQLHGIYVLAQNARGMVLVDMH
AAHERILYEQLKTALEARRVEVQPLLIPVTLAASPVEIGTAEEFRDTLTLLGFDISAVSP
TTLAVRAVPTLLQKADAQALARDVLRDLQAYGGSRVLAERQNELLATLACHSAVRANRRL
NLGEMNALLRQMEATERADQCNHGRPTWIQLTVADLDRLFLRGQ