Protein Info for UW163_RS08340 in Ralstonia solanacearum UW163

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 transmembrane" amino acids 14 to 48 (35 residues), see Phobius details amino acids 63 to 87 (25 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 216 to 235 (20 residues), see Phobius details amino acids 241 to 267 (27 residues), see Phobius details amino acids 274 to 295 (22 residues), see Phobius details amino acids 309 to 339 (31 residues), see Phobius details PF01594: AI-2E_transport" amino acids 17 to 341 (325 residues), 190.1 bits, see alignment E=3.1e-60

Best Hits

KEGG orthology group: None (inferred from 98% identity to rsc:RCFBP_10823)

Predicted SEED Role

"Putative permease often clustered with de novo purine synthesis" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>UW163_RS08340 AI-2E family transporter (Ralstonia solanacearum UW163)
MNAPLLTQDTKRTLAWIAVAVIFLALLKLLAPTLTPFVFAFILSYILHPGVEWLQRHRVP
RVLGVFLMVLLLAVMAVALMLLILAVLQREIPAIREQLPGMLSKLNAAVTPRLAEMGVHV
RFDFPGLRKLLTEQLASSPEDVMSTALNYLRVSGSAAVQLLGIVFLVPIVMFYLLMDWNM
LMRRLEGVVPRHWIGKTRELATETDGLLSQYLRGQIIVMLVLAVYYSSGLALAGFDVALP
IGIFTGLAVFIPYIGFGIGLTLAILSALLQFGNLYGLLAVAVVYGIGQVLEGFYLTPRLV
GERIGLHPLAVILALLAFGQLFGFFGILLALPISAVLLVGLRQIRQLYLGSKLYRD