Protein Info for UW163_RS08305 in Ralstonia solanacearum UW163

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 235 transmembrane" amino acids 20 to 20 (1 residues), see Phobius details amino acids 24 to 49 (26 residues), see Phobius details amino acids 60 to 84 (25 residues), see Phobius details amino acids 96 to 121 (26 residues), see Phobius details amino acids 152 to 175 (24 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 44 to 224 (181 residues), 31.4 bits, see alignment E=8.1e-12

Best Hits

Swiss-Prot: 44% identical to ANTRP_HALVD: Probable anion ABC transporter permease protein HVO_1887 (HVO_1887) from Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2)

KEGG orthology group: K05773, putative tungstate transport system permease protein (inferred from 96% identity to rsc:RCFBP_10816)

Predicted SEED Role

"ABC-type tungstate transport system, permease protein" in subsystem ABC transporter tungstate (TC 3.A.1.6.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (235 amino acids)

>UW163_RS08305 ABC transporter permease (Ralstonia solanacearum UW163)
MDICSATVDAFALLARGDAALWVIVWTSLKVAVAGLLLAAPPALLMAYAVAMHRFPGRRV
LVVLAQASLSFPTVLIGLVLYLLLSRQGPLGGFGLLFTQGGMILGQAVLGLPVIVAFALA
TFERADPRLAETARVLGAGPVRRLLTVFRELRFGLGAAVVAGFGRVIAEVGSALMVGGNI
EGITRTMTTAIALETSKGEFAQGIALGIVLIALALLVNLVLAWLQGAGTFRRHTA